Rabbit Polyclonal Anti-SART3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SART3 antibody: synthetic peptide directed towards the N terminal of human SART3. Synthetic peptide located within the following region: TSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWD |
Rabbit Polyclonal Anti-SART3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SART3 antibody: synthetic peptide directed towards the middle region of human SART3. Synthetic peptide located within the following region: LSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLR |
Goat Polyclonal Antibody against SART3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-MSNADFAKLFLRK, from the C Terminus of the protein sequence according to NP_055521.1. |
Rabbit Polyclonal Anti-SART3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SART3 Antibody: synthetic peptide directed towards the middle region of human SART3. Synthetic peptide located within the following region: VKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAIS |
SART3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 664-963 of human SART3 (NP_055521.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
