RBFOX2 Rabbit Polyclonal Antibody

CAT#: TA343808

Rabbit Polyclonal Anti-RBM9 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of RNA binding motif protein 9 (RBM9), transcript variant 2
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "RBFOX2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RBM9 antibody: synthetic peptide directed towards the middle region of human RBM9. Synthetic peptide located within the following region: PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name RNA binding protein, fox-1 homolog 2
Background RBM9 is a RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.
Synonyms dJ106I20.3; Fox-2; FOX2; fxh; HNRBP2; HRNBP2; RBM9; RTA
Note Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Horse: 85%; Yeast: 85%; Goat: 76%; Bovine: 75%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.