EXOSC3 Rabbit Polyclonal Antibody

CAT#: TA343837

Rabbit Polyclonal Anti-EXOSC3 Antibody

Product Images

Host: Rabbit; Target Name: EXOSC3; Sample Tissue: Esophagus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EXOSC3 antibody is: synthetic peptide directed towards the C-terminal region of Human EXOSC3. Synthetic peptide located within the following region: RNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: exosome component 3
• Database Link:
  NP_057126
  Entrez Gene 51010 Human
  UniProt ID Q9NQT5
• Background: EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.
• Synonyms: bA3J10.7; CGI-102; hRrp-40; p10; PCH1B; RRP40; Rrp40p
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 86%; Yeast: 75%

Reference Data

• Protein Families: Stem cell - Pluripotency
• Protein Pathways: RNA degradation