NIFK Rabbit Polyclonal Antibody

CAT#: TA343954

Rabbit Polyclonal Anti-MKI67IP Antibody

Product Images

WB Suggested Anti-MKI67IP Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MKI67IP antibody: synthetic peptide directed towards the middle region of human MKI67IP. Synthetic peptide located within the following region: QPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: nucleolar protein interacting with the FHA domain of MKI67
• Database Link:
  NP_115766
  Entrez Gene 84365 Human
  UniProt ID Q9BYG3
• Background: The function remains unknown.
• Synonyms: MKI67IP; Nopp34
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Rabbit: 93%; Mouse: 92%; Horse: 86%; Bovine: 86%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transcription Factors