HNRPLL (HNRNPLL) Rabbit Polyclonal Antibody

CAT#: TA343980

Rabbit Polyclonal Anti-HNRPLL Antibody

Product Images

WB Suggested Anti-HNRPLL Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: HNRPLL; Sample Tissue: HepG2; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 2.5 ug/mL; Peptide Concentration: 2.0 ug/mL; Lysate Quantity: 25 ug/lane; Gel Concentration: 12

• 

  Rabbit Anti-HNRPLL Antibody; Paraffin Embedded Tissue: Human Heart; Cellular Data: Myocardial cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-HNRPLL Antibody; Paraffin Embedded Tissue: Human Lung; Cellular Data: Alveolar cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HNRPLL antibody: synthetic peptide directed towards the N terminal of human HNRPLL. Synthetic peptide located within the following region: RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: heterogeneous nuclear ribonucleoprotein L like
• Database Link:
  NP_612403
  Entrez Gene 92906 Human
  UniProt ID Q8WVV9
• Background: HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.
• Synonyms: HNRPLL; SRRF
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%