ALKBH8 Rabbit Polyclonal Antibody

CAT#: TA343982

Rabbit Polyclonal Anti-ALKBH8 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of alkB, alkylation repair homolog 8 (E. coli) (ALKBH8)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "ALKBH8"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ALKBH8 antibody: synthetic peptide directed towards the N terminal of human ALKBH8. Synthetic peptide located within the following region: MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 27 kDa
Gene Name alkB homolog 8, tRNA methyltransferase
Background The function remains unknown.
Synonyms ABH8; TRM9; TRMT9
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Pig: 86%; Horse: 86%; Rat: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.