APOBEC3D Rabbit Polyclonal Antibody

CAT#: TA344007

Rabbit Polyclonal Anti-APOBEC3D Antibody

Product Images

WB Suggested Anti-APOBEC3D Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Rabbit Anti-APOBEC3D Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-APOBEC3D antibody: synthetic peptide directed towards the N terminal of human APOBEC3D. Synthetic peptide located within the following region: SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: apolipoprotein B mRNA editing enzyme catalytic subunit 3D
• Database Link:
  NP_689639
  Entrez Gene 140564 Human
• Background: This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.
• Synonyms: A3D; APOBEC3DE; APOBEC3E; ARP6
• Note: Immunogen Sequence Homology: Human: 100%