HEXO (ERI1) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of exoribonuclease 1 (ERI1)
USD 396.00
Other products for "ERI1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-THEX1 antibody: synthetic peptide directed towards the N terminal of human THEX1. Synthetic peptide located within the following region: EPPRPSPEETQQCKFDGQETKGSKFITSSASDFSDPVYKEIAITNGCINR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 40 kDa |
Gene Name | exoribonuclease 1 |
Database Link | |
Background | THEX1 contains 1 SAP domain and 1 exonuclease domain. It is an RNA exonuclease that binds to the 3' end of histone mRNAs and probably degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. It is also able to degrade the 3' overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi). |
Synonyms | 3 HEXO; 3'HEXO; HEXO; THEX1 |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Horse: 86%; Guinea pig: 86%; Mouse: 85%; Rat: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.