Cornulin (CRNN) Rabbit Polyclonal Antibody

CAT#: TA344123

Rabbit Polyclonal Anti-CRNN Antibody

Product Images

WB Suggested Anti-CRNN Antibody; Titration: 1.0 ug/ml; Positive Control: HT1080 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CRNN antibody: synthetic peptide directed towards the middle region of human CRNN. Synthetic peptide located within the following region: GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: cornulin
• Database Link:
  NP_057274
  Entrez Gene 49860 Human
  UniProt ID Q9UBG3
• Background: This gene encodes a member of the 'fused gene' family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation.
• Synonyms: C1orf10; DRC1; PDRC1; SEP53
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 85%; Horse: 79%