ERMAP Rabbit Polyclonal Antibody

CAT#: TA344157

Rabbit Polyclonal Anti-ERMAP Antibody

Product Images

WB Suggested Anti-ERMAP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ERMAP antibody: synthetic peptide directed towards the middle region of human ERMAP. Synthetic peptide located within the following region: RSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: erythroblast membrane associated protein (Scianna blood group)
• Database Link:
  NP_061008
  Entrez Gene 114625 Human
  UniProt ID Q96PL5
• Background: ERMAP is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in the gene encoding ERMAP protein are responsible for the Scianna/Radin blood group system. The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene.
• Synonyms: BTN5; PRO2801; RD; SC
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Pig: 92%; Rabbit: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome, Transmembrane