MAGT1 Rabbit Polyclonal Antibody

CAT#: TA344228

Rabbit Polyclonal Anti-RP11-217H1.1 Antibody - N-terminal region

Product Images

WB Suggested Anti-RP11-217H1.1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human brain

• 

  Host: Rabbit; Target Name: MAGT1; Sample Tissue: PANC1; Antibody Dilution: 1.0 ug/ml; MAGT1 is supported by BioGPS gene expression data to be expressed in PANC1

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RP11-217H1.1 antibody: synthetic peptide directed towards the N terminal of human RP11-217H1.1. Synthetic peptide located within the following region: ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: magnesium transporter 1
• Database Link:
  NP_115497
  Entrez Gene 84061 Human
  UniProt ID Q9H0U3
• Background: The specific function of this protein remains unknown.
• Synonyms: bA217H1.1; IAP; MRX95; OST3B; PRO0756; XMEN
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 91%

Reference Data

• Protein Families: Druggable Genome, Transmembrane