IMPA1 Rabbit Polyclonal Antibody

CAT#: TA344233

Rabbit Polyclonal Anti-IMPA1 Antibody - middle region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), transcript variant 1
    • 20 ug

USD 823.00


Transient overexpression lysate of inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), transcript variant 1
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "IMPA1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-IMPA1 antibody: synthetic peptide directed towards the middle region of human IMPA1. Synthetic peptide located within the following region: IVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 30 kDa
Gene Name inositol monophosphatase 1
Background IMPA1 is responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain. IMPA1 can use myo-inositol monophosphates, myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates.
Synonyms IMP; IMPA
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rat: 92%; Guinea pig: 86%; Mouse: 85%; Horse: 79%; Rabbit: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.