IMPA1 Rabbit Polyclonal Antibody

CAT#: TA344233

Rabbit Polyclonal Anti-IMPA1 Antibody - middle region

Product Images

WB Suggested Anti-IMPA1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IMPA1 antibody: synthetic peptide directed towards the middle region of human IMPA1. Synthetic peptide located within the following region: IVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: inositol monophosphatase 1
• Database Link:
  NP_005527
  Entrez Gene 3612 Human
  UniProt ID P29218
• Background: IMPA1 is responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain. IMPA1 can use myo-inositol monophosphates, myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates.
• Synonyms: IMP; IMPA
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rat: 92%; Guinea pig: 86%; Mouse: 85%; Horse: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system