MVP Rabbit Polyclonal Antibody

CAT#: TA344252

Rabbit Polyclonal Anti-MVP Antibody - N-terminal region

Product Images

WB Suggested Anti-MVP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MVP antibody: synthetic peptide directed towards the N terminal of human MVP. Synthetic peptide located within the following region: MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 98 kDa
• Gene Name: major vault protein
• Database Link:
  NP_005106
  Entrez Gene 9961 Human
  UniProt ID Q14764
• Background: MVP is required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. MVP down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. MVP down-regulates SRC activity and signaling through MAP kinases.This gene encodes the major vault protein which is a lung resistance-related protein. Vaults are multi-subunit structures that may be involved in nucleo-cytoplasmic transport. This protein mediates drug resistance, perhaps via a transport process. It is widely distributed in normal tissues, and overexpressed in multidrug-resistant cancer cells. The protein overexpression is a potentially useful marker of clinical drug resistance. This gene produces two transcripts by using two alternative exon 2 sequences; however, the open reading frames are the same in both transcripts.
• Synonyms: LRP; VAULT1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome