Eph receptor A3 (EPHA3) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of EPH receptor A3 (EPHA3), transcript variant 1
USD 396.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 159.00
Other products for "EPHA3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-EPHA3 antibody is: synthetic peptide directed towards the N-terminal region of Human EPHA3. Synthetic peptide located within the following region: SVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 59 kDa |
Gene Name | EPH receptor A3 |
Database Link | |
Background | This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Two alternatively spliced transcript variants have been described for this gene. |
Synonyms | EK4; ETK; ETK1; HEK; HEK4; TYRO4 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Bovine: 92%; Zebrafish: 92% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase, Secreted Protein, Transmembrane |
Protein Pathways | Axon guidance |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.