ERCC8 Rabbit Polyclonal Antibody

CAT#: TA344281

Rabbit Polyclonal Anti-ERCC8 Antibody - middle region

Product Images

WB Suggested Anti-ERCC8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: ERCC excision repair 8, CSA ubiquitin ligase complex subunit
• Database Link:
  NP_000073
  Entrez Gene 1161 Human
  UniProt ID Q13216
• Background: ERCC8 is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS).
• Synonyms: CKN1; CSA; UVSS2
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 90%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Nucleotide excision repair, Ubiquitin mediated proteolysis