LRP1 Rabbit Polyclonal Antibody

CAT#: TA344286

Rabbit Polyclonal Anti-LRP1 Antibody - middle region

Product Images

WB Suggested Anti-LRP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: 721_B cell lysate

• 

  Lanes : Human placenta Primary Antibody Dilution : 1:500 Secondary Antibody : Anti-rabbit-HRP Secondary Antibody Dilution : 1:5000 Gene Name : Brown: LRP1 Purple: Haemotoxylin Submitted by : LRP1

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LRP1 antibody: synthetic peptide directed towards the middle region of human LRP1. Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: LDL receptor related protein 1
• Database Link:
  NP_002323
  Entrez Gene 4035 Human
  UniProt ID Q07954
• Background: Low-density lipoprotein receptor-related protein 1 (.-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.
• Synonyms: A2MR; APOER; APR; CD91; IGFBP3R; LRP; LRP1A; TGFBR5
• Note: Immunogen Sequence Homology:

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Alzheimer's disease