Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody

CAT#: TA344294

Rabbit Polyclonal Anti-SPTAN1 Antibody - N-terminal region

Product Images

WB Suggested Anti-SPTAN1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Hela cell lysateSPTAN1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

• 

  Immunohistochemistry with NT-2 cell line, mouse brain, and rat brain tissue

• 

  Amount and Sample Type : 500 ug mouse brain homogenate; Amount of IP Antibody : 6 ug; Primary Antibody : SPTAN1; Primary Antibody Dilution : 1:500; Secondary Antibody : Goat anti-rabbit Alexa-Fluor 594; Secondary Antibody Dilution : 1:5000; Gene Name : SP

Specifications

Product Data

• Applications: IHC, IP, WB
• Recommended Dilution: WB, IHC, IP
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1. Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 272 kDa
• Gene Name: spectrin alpha, non-erythrocytic 1
• Database Link:
  NP_003118
  Entrez Gene 20740 MouseEntrez Gene 64159 RatEntrez Gene 6709 Human
  UniProt ID Q13813
• Background: Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.
• Synonyms: EIEE5; NEAS; SPTA2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Tight junction