CCDC74A Rabbit Polyclonal Antibody

CAT#: TA344341

Rabbit Polyclonal Anti-CCDC74A Antibody - middle region

Product Images

WB Suggested Anti-CCDC74A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCDC74A antibody: synthetic peptide directed towards the middle region of human CCDC74A. Synthetic peptide located within the following region: FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: coiled-coil domain containing 74A
• Database Link:
  NP_620125
  Entrez Gene 90557 Human
  UniProt ID Q96AQ1
• Background: The exact function of CCDC74A remains unknown.
• Synonyms: CCDC74AV2; CCDC74AV3; FLJ40345
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 86%; Rabbit: 86%