alpha Actinin (ACTN1) Rabbit Polyclonal Antibody

CAT#: TA344352

Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region

Product Images

ACTN1 antibody - N-terminal region validated by WB using 1.-2.Rat cortical neurons ctr siRNA (30ug); 2. Rat cortical neurons ACTN1 siRNA (30ug) at 1:1000-1:2000.

• 

  WB Suggested Anti-ACTN1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 293T cell lysate

• 

  Sample Type: 1.-4. rACTN1-GFP + HEK293 (50ug); Primary Dilution: 1:1000-1:2000; Secondary Antibody: HRP conjugated goat anti-rabbit; Secondary Dilution: 1:20,000; Image Submitted By: Magdalena Kalinowska; Albert Einstein College of Medicine??????

• 

  Lanes: Lane 1: 10 ug ACTN1-GFP transfected COS-7 lysate; Lane 2: 10 ug ACTN2-GFP transfected COS-7 lysate; Lane 3: 10 ug ACTN3-GFP transfected COS-7 lysate; Lane 4: 10 ug ACTN4-GFP transfected COS-7 lysate; Primary Antibody Dilution: 1:1000; Secondary Antibod

• 

  Sample Type : ACTNX-GFP transfected COS-7 cellsPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-Alexa-Fluor 568Secondary Antibody Dilution : 1:100Color/Signal Descriptions : Green: GFP Red: ACTN1Gene Name : ACTN1Submitted by : Johannes W

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 103 kDa
• Gene Name: actinin alpha 1
• Database Link:
  NP_001093
  Entrez Gene 81634 RatEntrez Gene 87 Human
  UniProt ID P12814
• Background: Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, cytoskeletal, alpha actinin isoform and maps to the same site as the structurally similar erythroid beta spectrin gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: BDPLT15
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%; Horse: 75%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS
• Protein Pathways: Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Systemic lupus erythematosus, Tight junction