IGF2BP1 Rabbit Polyclonal Antibody

CAT#: TA344358

Rabbit Polyclonal Anti-IGF2BP1 Antibody - N-terminal region

Product Images

WB Suggested Anti-IGF2BP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

• 

  Researcher:Haodong Xu. Department of Pathology, University of Rochester medical Center; Application: IHC; Species+tissue/cell type: Human small intestine; Primary antibody dilution: 1:300; Secondary antibody: Anti-rabbit-linker, Fbex-HRP

• 

  Sample Type : Human lung carcinomaPrimary Antibody Dilution : 1:300Secondary Antibody : Anti-rabbit-linker, Fbex-HRPSecondary Antibody Dilution : NOT FOUNDColor/Signal Descriptions : Brown: IGFBP1 Blue: NucleiGene Name : IGF2BP1Submitted by : Haodong Xu.

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IGF2BP1 antibody: synthetic peptide directed towards the N terminal region of human IGF2BP1. Synthetic peptide located within the following region: AFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: insulin like growth factor 2 mRNA binding protein 1
• Database Link:
  NP_006537
  Entrez Gene 140486 MouseEntrez Gene 10642 Human
  UniProt ID Q9NZI8
• Background: IGF2BP1 is a member of the IGF-II mRNA-binding protein (IMP) family. The protein contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CRD-BP; CRDBP; IMP-1; IMP1; VICKZ1; ZBP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%