PDS5B Rabbit Polyclonal Antibody

CAT#: TA344381

Rabbit Polyclonal Anti-PDS5B Antibody - middle region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "PDS5B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PDS5B antibody: synthetic peptide directed towards the middle region of human PDS5B. Synthetic peptide located within the following region: DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 159 kDa
Gene Name PDS5 cohesin associated factor B
Background PDS5B plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis. Defects in PDS5B may be the cause of some cancers including esophageal cancer.
Synonyms APRIN; AS3; CG008
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 85%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.