XPF (ERCC4) Rabbit Polyclonal Antibody

CAT#: TA344393

Rabbit Polyclonal Anti-ERCC4 Antibody - middle region

Product Images

WB Suggested Anti-ERCC4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: PANC1 cell lysateERCC4 is supported by BioGPS gene expression data to be expressed in PANC1

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ERCC4 antibody: synthetic peptide directed towards the middle region of human ERCC4. Synthetic peptide located within the following region: FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 101 kDa
• Gene Name: ERCC excision repair 4, endonuclease catalytic subunit
• Database Link:
  NP_005227
  Entrez Gene 2072 Human
  UniProt ID Q92889
• Background: The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1. Defects in this gene are a cause
• Synonyms: ERCC11; FANCQ; RAD1; XFEPS; XPF
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 85%; Horse: 85%; Dog: 83%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Nucleotide excision repair