PTOP (ACD) Rabbit Polyclonal Antibody

CAT#: TA344401

Rabbit Polyclonal Anti-ACD Antibody - middle region

Product Images

WB Suggested Anti-ACD Antibody Titration: 0.2-1 ug/ml; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACD antibody: synthetic peptide directed towards the middle region of human ACD. Synthetic peptide located within the following region: KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: adrenocortical dysplasia homolog
• Database Link:
  NP_001075955
  Entrez Gene 65057 Human
  UniProt ID Q96AP0
• Background: ACD is a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other comp
• Synonyms: PIP1; PTOP; TINT1; TPP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 85%