ARA9 (AIP) Rabbit Polyclonal Antibody

CAT#: TA344441

Rabbit Polyclonal Anti-AIP Antibody - N-terminal region

Product Images

WB Suggested Anti-AIP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysateAIP is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AIP antibody: synthetic peptide directed towards the N terminal of human AIP. Synthetic peptide located within the following region: FHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: aryl hydrocarbon receptor interacting protein
• Database Link:
  NP_003968
  Entrez Gene 9049 Human
  UniProt ID O00170
• Background: AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein. AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: ARA9; FKBP16; FKBP37; SMTPHN; XAP-2; XAP2
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Dog: 79%; Horse: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors