JMJD5 (KDM8) Rabbit Polyclonal Antibody

CAT#: TA344450

Rabbit Polyclonal Anti-JMJD5 Antibody - middle region

Product Images

WB Suggested Anti-JMJD5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Liver

• 

  Host: Rabbit; Target Name: JMJD5; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Chromatin Immunoprecipitation (ChIP) Using JMJD5 antibody - middle region and HCT116 Cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB, ChIP
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-JMJD5 antibody: synthetic peptide directed towards the middle region of human JMJD5. Synthetic peptide located within the following region: KYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: lysine demethylase 8
• Database Link:
  NP_079049
  Entrez Gene 79831 Human
  UniProt ID Q8N371
• Background: JMJD5 is a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor.JMJD5 is a putative histone lysine demethylase that contains a Jumonji C (JmjC) domain (Shi, 2007 [PubMed 17909537]). [supplied by OMIM]
• Synonyms: JMJD5
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 92%; Zebrafish: 92%; Guinea pig: 92%