ZFP37 Rabbit Polyclonal Antibody

CAT#: TA344475

Rabbit Polyclonal Anti-Zfp566 Antibody - middle region

Product Images

Host: Rabbit; Target Name: Zfp566; Sample Tissue: Rat Spleen lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Zfp566 antibody: synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI. Synthetic peptide located within the following region: YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: ZFP37 zinc finger protein
• Database Link:
  NP_003399
  Entrez Gene 115768 Rat
  UniProt ID Q9Y6Q3
• Background: The function of this protein remains unknown.
• Synonyms: zfp-37; ZNF906
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors