ZNF334 Rabbit Polyclonal Antibody

CAT#: TA344476

Rabbit Polyclonal Anti-ZNF334 Antibody - N-terminal region

Product Images

WB Suggested Anti-ZNF334 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF334 antibody: synthetic peptide directed towards the N terminal of human ZNF334. Synthetic peptide located within the following region: KMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 80 kDa
• Gene Name: zinc finger protein 334
• Database Link:
  NP_060572
  Entrez Gene 55713 Human
  UniProt ID Q9HCZ1
• Background: ZNF334 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 14 C2H2-type zinc fingers and 1 KRAB domain. ZNF334 may be involved in transcriptional regulation.
• Synonyms: OTTHUMP00000031209; zinc finger protein 334
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%

Reference Data

• Protein Families: Transcription Factors