HLX1 (HLX) Rabbit Polyclonal Antibody

CAT#: TA344489

Rabbit Polyclonal Anti-HLX Antibody - middle region

Product Images

WB Suggested Anti-HLX Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HLX antibody: synthetic peptide directed towards the middle region of human HLX. Synthetic peptide located within the following region: WFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAPAADGEQDERSPSRSEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: H2.0 like homeobox
• Database Link:
  NP_068777
  Entrez Gene 3142 Human
  UniProt ID Q14774
• Background: HLX is a transcription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance of Th1-specific gene expression. Involved in embryogenesis and hematopoiesis.
• Synonyms: HB24; HLX1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 75%

Reference Data

• Protein Families: Transcription Factors