KLF15 Rabbit Polyclonal Antibody

CAT#: TA344498

Rabbit Polyclonal Anti-KLF15 Antibody - N-terminal region

Product Images

WB Suggested Anti-Klf15 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Klf15 antibody is: synthetic peptide directed towards the N-terminal region of Klf15. Synthetic peptide located within the following region: MVDHLLPVDETFSSPKCSVGYLGDRLASRQPYHMLPSPISEDDSDVSSPC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: Kruppel-like factor 15
• Database Link:
  NP_054798
  Entrez Gene 66277 Mouse
  UniProt ID Q9UIH9
• Background: The function of this protein remains unknown.
• Synonyms: KKLF
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Guinea pig: 93%; Bovine: 92%; Horse: 91%

Reference Data

• Protein Families: Transcription Factors