CSN1 (GPS1) Rabbit Polyclonal Antibody

CAT#: TA344499

Rabbit Polyclonal Anti-GPS1 Antibody - N-terminal region

Product Images

WB Suggested Anti-GPS1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPS1 antibody: synthetic peptide directed towards the N terminal of human GPS1. Synthetic peptide located within the following region: PLPVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: G protein pathway suppressor 1
• Database Link:
  NP_004118
  Entrez Gene 2873 Human
  UniProt ID Q13098
• Background: This protein is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. It shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. This gene is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. The encoded protein shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: COPS1; CSN1; SGN1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome