EVX1 Rabbit Polyclonal Antibody
Frequently bought together (2)
Other products for "EVX1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EVX1 antibody: synthetic peptide directed towards the N terminal of human EVX1. Synthetic peptide located within the following region: PEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 42 kDa |
Gene Name | even-skipped homeobox 1 |
Database Link | |
Background | EVX1 is a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The protein may play an important role as a transcriptional repressor during embryogenesis.This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-343 AC004080.2 115915-116257 344-1717 X60655.1 86-1459 1718-1858 AC004080.2 119803-119943 |
Synonyms | EVX-1 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rabbit: 92%; Dog: 86%; Pig: 86%; Bovine: 86%; Guinea pig: 86%; Goat: 80%; Rat: 79%; Mouse: 79% |
Reference Data | |
Protein Families | ES Cell Differentiation/IPS |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.