EAP30 (SNF8) Rabbit Polyclonal Antibody

CAT#: TA344525

Rabbit Polyclonal Anti-SNF8 Antibody - middle region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) (SNF8)
    • 20 ug

USD 823.00


Transient overexpression lysate of SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) (SNF8)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "SNF8"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SNF8 antibody: synthetic peptide directed towards the middle region of human SNF8. Synthetic peptide located within the following region: DHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name SNF8, ESCRT-II complex subunit
Background ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor.
Synonyms Dot3; EAP30; VPS22
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%
Reference Data
Protein Families Transcription Factors
Protein Pathways Endocytosis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.