ARIH2 Rabbit Polyclonal Antibody

CAT#: TA344535

Rabbit Polyclonal Anti-ARIH2 Antibody - N-terminal region

Product Images

WB Suggested Anti-ARIH2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARIH2 antibody: synthetic peptide directed towards the N terminal of human ARIH2. Synthetic peptide located within the following region: MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: ariadne RBR E3 ubiquitin protein ligase 2
• Database Link:
  NP_006312
  Entrez Gene 10425 Human
  UniProt ID O95376
• Background: ARIH2 is the E3 ubiquitin-protein ligase mediating 'Lys-48'-and 'Lys-63'-linked polyubiquitination and subsequent proteasomal degradation of modified proteins. 'ARIH2 may play a role in myelopoiesis.
• Synonyms: ARI2; TRIAD1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome