PREB Rabbit Polyclonal Antibody

CAT#: TA344537

Rabbit Polyclonal Anti-PREB Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: Preb; Sample Tissue: Mouse Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Preb antibody is synthetic peptide directed towards the N-terminal region of Mouse Preb. Synthetic peptide located within the following region: RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: prolactin regulatory element binding
• Database Link:
  NP_037520
  Entrez Gene 50907 Mouse
  UniProt ID Q9HCU5
• Background: Preb was first identified based on its probable role in the regulation of pituitary gene transcription. It binds to the prolactin gene (PRL) promoter and seems to activate transcription. Guanine nucleotide exchange factor that activates SARA2. It is also required for the formation of COPII transport vesicles from the ER.
• Synonyms: SEC12
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors, Transmembrane