SERPINB8 Rabbit Polyclonal Antibody

CAT#: TA344595

Rabbit Polyclonal Anti-SERPINB8 Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: SERPINB8; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SERPINB8 antibody is: synthetic peptide directed towards the N-terminal region of Human SERPINB8. Synthetic peptide located within the following region: TAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: serpin family B member 8
• Database Link:
  NP_942130
  Entrez Gene 5271 Human
  UniProt ID P50452
• Background: The superfamily of high molecular weight serine proteinase inhibitors (serpins) regulate a diverse set of intracellular and extracellular processes such as complement activation, fibrinolysis, coagulation, cellular differentiation, tumor suppression, apoptosis, and cell migration. Serpins are characterized by well-conserved a tertiary structure that consists of 3 beta sheets and 8 or 9 alpha helices (Huber and Carrell, 1989 [PubMed 2690952]). A critical portion of the molecule, the reactive center loop connects beta sheets A and C. Protease inhibitor-8 (PI8; SERPINB8) is a member of the ov-serpin subfamily, which, relative to the archetypal serpin PI1 (MIM 107400), is characterized by a high degree of homology to chicken ovalbumin, lack of N- and C-terminal extensions, absence of a signal peptide, and a serine rather than an asparagine residue at the penultimate position (summary by Bartuski et al., 1997 [PubMed 9268635]).
• Synonyms: CAP2; PI8
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 92%; Bovine: 90%; Pig: 86%; Rat: 86%; Horse: 86%; Dog: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome