PPM1B Rabbit Polyclonal Antibody

CAT#: TA344615

Rabbit Polyclonal Anti-PPM1B Antibody - N-terminal region

Product Images

WB Suggested Anti-PPM1B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPM1B antibody: synthetic peptide directed towards the N terminal of human PPM1B. Synthetic peptide located within the following region: EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: protein phosphatase, Mg2+/Mn2+ dependent 1B
• Database Link:
  NP_808908
  Entrez Gene 5495 Human
  UniProt ID O75688
• Background: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent
• Synonyms: PP2C-beta; PP2C-beta-X; PP2CB; PP2CBETA; PPC2BETAX
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome, Phosphatase, Stem cell - Pluripotency
• Protein Pathways: MAPK signaling pathway