NASP Rabbit Polyclonal Antibody

CAT#: TA344626

Rabbit Polyclonal Anti-NASP Antibody - middle region

Product Images

WB Suggested Anti-NASP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysateNASP is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  Testis

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NASP antibody: synthetic peptide directed towards the middle region of human NASP. Synthetic peptide located within the following region: KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: nuclear autoantigenic sperm protein
• Database Link:
  NP_689511
  Entrez Gene 4678 Human
  UniProt ID P49321
• Background: This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene. The somatic form is expressed in all mitotic cells, is localize
• Synonyms: FLB7527; HMDRA1; PRO1999
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Horse: 93%; Guinea pig: 93%