Rad51L1 (RAD51B) Rabbit Polyclonal Antibody
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 159.00
Other products for "RAD51B"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RAD51L1 antibody: synthetic peptide directed towards the middle region of human RAD51L1. Synthetic peptide located within the following region: TESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 38 kDa |
Gene Name | RAD51 paralog B |
Database Link | |
Background | The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed. |
Synonyms | R51H2; RAD51L1; REC2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Horse: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Homologous recombination |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.