TEKT3 Rabbit Polyclonal Antibody

CAT#: TA344658

Rabbit Polyclonal Anti-TEKT3 Antibody - N-terminal region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human tektin 3 (TEKT3)
    • 20 ug

USD 823.00


Transient overexpression lysate of tektin 3 (TEKT3)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "TEKT3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Tekt3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 54 kDa
Gene Name tektin 3
Background Tekt3 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules. It is required for progressive sperm mobility.
Synonyms FLJ32828
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.