IPPK Rabbit Polyclonal Antibody

CAT#: TA344669

Rabbit Polyclonal Anti-Ippk Antibody - C-terminal region

Product Images

WB Suggested Anti-Ippk Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ippk antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQGTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: inositol-pentakisphosphate 2-kinase
• Database Link:
  NP_073592
  Entrez Gene 75678 Mouse
  UniProt ID Q9H8X2
• Background: The function of this protein remains unknown.
• Synonyms: bA476B13.1; C9orf12; INSP5K2; IP5K; IPK1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%

Reference Data

• Protein Pathways: Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system