RRAGC Rabbit Polyclonal Antibody

CAT#: TA344689

Rabbit Polyclonal Anti-RRAGC Antibody - N-terminal region

Product Images

WB Suggested Anti-RRAGC Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: A549 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RRAGC antibody: synthetic peptide directed towards the N terminal of human RRAGC. Synthetic peptide located within the following region: RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: Ras related GTP binding C
• Database Link:
  NP_071440
  Entrez Gene 64121 Human
  UniProt ID Q9HB90
• Background: RRAGC is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.
• Synonyms: GTR2; RAGC; TIB929
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Transcription Factors