FKBPL Rabbit Polyclonal Antibody

CAT#: TA344698

Rabbit Polyclonal Anti-FKBPL Antibody - N-terminal region

Product Images

WB Suggested Anti-FKBPL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FKBPL antibody: synthetic peptide directed towards the N terminal of human FKBPL. Synthetic peptide located within the following region: AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: FK506 binding protein like
• Database Link:
  NP_071393
  Entrez Gene 63943 Human
  UniProt ID Q9UIM3
• Background: The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The encoded protein is thought to have a potential role in the induced radioresistance. Also it appears to have some involvement in the control of the cell cycle.
• Synonyms: DIR1; NG7; WISP39
• Note: Immunogen Sequence Homology: Human: 100%