C5orf54 (ZBED8) Rabbit Polyclonal Antibody

CAT#: TA344705

Rabbit Polyclonal Anti-C5orf54 Antibody - N-terminal region

Product Images

WB Suggested Anti-C5orf54 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C5orf54 antibody: synthetic peptide directed towards the N terminal of human LOC63920. Synthetic peptide located within the following region: SVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMPAPSDQSETLKAFGV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: zinc finger BED-type containing 8
• Database Link:
  NP_071373
  Entrez Gene 63920 Human
  UniProt ID Q8IZ13
• Background: The function of this protein remains unknown.
• Synonyms: Buster3; C5orf54
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%