TRIB3 Rabbit Polyclonal Antibody
Frequently bought together (2)
Other products for "TRIB3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TRIB3 antibody: synthetic peptide directed towards the N terminal of human TRIB3. Synthetic peptide located within the following region: YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 39 kDa |
Gene Name | tribbles pseudokinase 3 |
Database Link | |
Background | The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. |
Synonyms | C20orf97; NIPK; SINK; SKIP3; TRB3 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%; Rat: 79%; Sheep: 79%; Bovine: 79% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.