TRIB3 Rabbit Polyclonal Antibody

CAT#: TA344735

Rabbit Polyclonal Anti-TRIB3 Antibody - N-terminal region

Product Images

WB Suggested Anti-TRIB3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIB3 antibody: synthetic peptide directed towards the N terminal of human TRIB3. Synthetic peptide located within the following region: YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: tribbles pseudokinase 3
• Database Link:
  NP_066981
  Entrez Gene 57761 Human
  UniProt ID Q96RU7
• Background: The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.
• Synonyms: C20orf97; NIPK; SINK; SKIP3; TRB3
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%; Rat: 79%; Sheep: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase, Transcription Factors