TRIB3 Rabbit Polyclonal Antibody

CAT#: TA344736

Rabbit Polyclonal Anti-TRIB3 Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: TRIB3; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TRIB3 antibody is: synthetic peptide directed towards the N-terminal region of Human TRIB3. Synthetic peptide located within the following region: KNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: tribbles pseudokinase 3
• Database Link:
  NP_066981
  Entrez Gene 57761 Human
  UniProt ID Q96RU7
• Background: The function of this protein remains unknown.
• Synonyms: C20orf97; NIPK; SINK; SKIP3; TRB3
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 91%; Sheep: 91%; Bovine: 91%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase, Transcription Factors