Scramblase 1 (PLSCR1) Rabbit Polyclonal Antibody

CAT#: TA344740

Rabbit Polyclonal Anti-PLSCR1 Antibody

Product Images

WB Suggested Anti-PLSCR1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Hela cell lysate

• 

  Host: Rabbit; Target Name: PLSCR1; Sample Tissue: Human 293T; Antibody Dilution: 1.0 ug/ml; PLSCR1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

• 

  Host: Rabbit; Target Name: PLSCR1; Sample Tissue: Human 721_B; Antibody Dilution: 1.0 ug/ml; PLSCR1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PLSCR1 antibody: synthetic peptide directed towards the N terminal of human PLSCR1. Synthetic peptide located within the following region: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: phospholipid scramblase 1
• Database Link:
  NP_066928
  Entrez Gene 5359 Human
  UniProt ID O15162
• Background: PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
• Synonyms: MMTRA1B
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency