LYRM1 Rabbit Polyclonal Antibody

CAT#: TA344781

Rabbit Polyclonal Anti-LYRM1 Antibody - middle region

Product Images

WB Suggested Anti-LYRM1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LYRM1 antibody: synthetic peptide directed towards the middle region of human LYRM1. Synthetic peptide located within the following region: KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: LYR motif containing 1
• Database Link:
  NP_065157
  Entrez Gene 57149 Human
  UniProt ID O43325
• Background: LYRM1 may promote cell proliferation and inhibition of apoptosis of preadipocytes.
• Synonyms: A211C6.1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 92%; Mouse: 85%