NT5M Rabbit Polyclonal Antibody

CAT#: TA344803

Rabbit Polyclonal Anti-NT5M Antibody - N-terminal region

Product Images

WB Suggested Anti-NT5M Antibody Titration: 0.2-1 ug/ml; Positive Control: A549 cell lysateNT5M is supported by BioGPS gene expression data to be expressed in A549

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NT5M antibody: synthetic peptide directed towards the N terminal of human NT5M. Synthetic peptide located within the following region: ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: 5',3'-nucleotidase, mitochondrial
• Database Link:
  NP_064586
  Entrez Gene 56953 Human
  UniProt ID Q9NPB1
• Background: This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
• Synonyms: dNT-2; dNT2; mdN
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%

Reference Data

• Protein Pathways: Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism