GRASP1 (GRIPAP1) Rabbit Polyclonal Antibody

CAT#: TA344807

Rabbit Polyclonal Anti-GRIPAP1 Antibody - N-terminal region

Product Images

WB Suggested Anti-GRIPAP1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GRIPAP1 antibody: synthetic peptide directed towards the N terminal of human GRIPAP1. Synthetic peptide located within the following region: ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 96 kDa
• Gene Name: GRIP1 associated protein 1
• Database Link:
  NP_064522
  Entrez Gene 56850 Human
  UniProt ID Q4V328
• Background: This gene encodes a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). In brain studies, the encoded protein was found with the GRIP/AMPA receptor complex. Multiple alternatively spliced transcript variants have been described that encode different protein isoforms; however, the full-length nature and biological validity of all of these variants have not been determined.
• Synonyms: GRASP-1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Bovine: 92%

Reference Data

• Protein Families: Druggable Genome