RAP1 (TERF2IP) Rabbit Polyclonal Antibody

CAT#: TA344831

Rabbit Polyclonal Anti-TERF2IP Antibody - middle region

Product Images

WB Suggested Anti-TERF2IP Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysateTERF2IP is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TERF2IP antibody: synthetic peptide directed towards the middle region of human TERF2IP. Synthetic peptide located within the following region: EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: TERF2 interacting protein
• Database Link:
  NP_061848
  Entrez Gene 54386 Human
  UniProt ID Q9NYB0
• Background: The gene encodes a protein that is part of a complex involved in telomere length regulation. Pseudogenes are present on chromosomes 5 and 22.
• Synonyms: DRIP5; RAP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 83%

Reference Data

• Protein Families: Transcription Factors